PDE4C (NM_001098819) Human Mass Spec Standard
CAT#: PH321103
PDE4C MS Standard C13 and N15-labeled recombinant protein (NP_001092289)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221103 |
Predicted MW | 67.6 kDa |
Protein Sequence |
>RC221103 representing NM_001098819
Red=Cloning site Green=Tags(s) MQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQ CLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRILNRELT HLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQ EEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVA YHNSLHAADVAQSTHVLLATPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASV LENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVL LLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKS QVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAE EEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001092289 |
RefSeq Size | 5124 |
RefSeq ORF | 1818 |
Synonyms | DPDE1; PDE21 |
Locus ID | 5143 |
UniProt ID | Q08493, Q32MM7, Q7KYS4 |
Cytogenetics | 19p13.11 |
Summary | 'The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]' |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420350 | PDE4C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420351 | PDE4C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC426049 | PDE4C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY420350 | Transient overexpression lysate of phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 3 |
USD 495.00 |
|
LY420351 | Transient overexpression lysate of phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 2 |
USD 495.00 |
|
LY426049 | Transient overexpression lysate of phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 2 |
USD 325.00 |
|
TP321103 | Recombinant protein of human phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 2 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review