Tryptophan 5 hydroxylase 2 (TPH2) (NM_173353) Human Mass Spec Standard

CAT#: PH321193

TPH2 MS Standard C13 and N15-labeled recombinant protein (NP_775489)

Product Images

Coomassie blue staining of purified TPH2 protein (Cat# TP321193). The protein was produced from HEK293T cells transfected with TPH2 cDNA clone (Cat# RC221193) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221193
• Predicted MW: 56.1 kDa
• Protein Sequence:
  Sequence Link

  >RC221193 representing NM_173353
  Red=Cloning site Green=Tags(s)
  
  MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATESGKTAVVFSL
  KNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFNELIQLLKFQTTIVTLNPPEN
  IWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRV
  EYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAG
  YLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDED
  VQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF
  VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775489
• RefSeq Size: 2360
• RefSeq ORF: 1470
• Synonyms: ADHD7; NTPH
• Locus ID: 121278
• UniProt ID: Q8IWU9
• Cytogenetics: 12q21.1
• Summary: This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tryptophan metabolism