alpha Lactalbumin (LALBA) (NM_002289) Human Mass Spec Standard

CAT#: PH321214

LALBA MS Standard C13 and N15-labeled recombinant protein (NP_002280)

Product Images

Coomassie blue staining of purified LALBA protein (Cat# TP321214). The protein was produced from HEK293T cells transfected with LALBA cDNA clone (Cat# RC221214) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221214
• Predicted MW: 16.22 kDa
• Protein Sequence:
  Sequence Link

  >RC221214 representing NM_002289
  Red=Cloning site Green=Tags(s)
  
  MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYG
  LFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCE
  KL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002280
• RefSeq Size: 742
• RefSeq ORF: 426
• Synonyms: LYZG
• Locus ID: 3906
• UniProt ID: P00709, A0A080YV01
• Cytogenetics: 12q13.11
• Summary: 'This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein
• Protein Pathways: Galactose metabolism