NDRG4 (NM_022910) Human Mass Spec Standard

CAT#: PH321301

NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_075061)

Product Images

Coomassie blue staining of purified NDRG4 protein (Cat# TP321301). The protein was produced from HEK293T cells transfected with NDRG4 cDNA clone (Cat# RC221301) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221301
• Predicted MW: 40.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221301 representing NM_022910
  Red=Cloning site Green=Tags(s)
  
  MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGNRPAILTYHD
  VGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYV
  IGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNN
  TELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNS
  KLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQA
  CTHSESSEGLGQVNHTMEVSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075061
• RefSeq Size: 3453
• RefSeq ORF: 1113
• Synonyms: BDM1; SMAP-8; SMAP8
• Locus ID: 65009
• UniProt ID: Q9ULP0, A0A024R6V8
• Cytogenetics: 16q21
• Summary: This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jun 2011]