NGF (NM_002506) Human Mass Spec Standard
CAT#: PH321463
NGF MS Standard C13 and N15-labeled recombinant protein (NP_002497)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221463 |
Predicted MW | 26.99 kDa |
Protein Sequence |
>RC221463 representing NM_002506
Red=Cloning site Green=Tags(s) MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVS VWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKA LTMDGKQAAWRFIRIDTACVCVLSRKAVRRA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002497 |
RefSeq Size | 1052 |
RefSeq ORF | 723 |
Synonyms | Beta-NGF; HSAN5; NGFB |
Locus ID | 4803 |
UniProt ID | P01138 |
Cytogenetics | 1p13.2 |
Summary | 'This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Apoptosis, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP321463 | Recombinant protein of human nerve growth factor (beta polypeptide) (NGF) |
USD 748.00 |
|
TP720591 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) |
USD 300.00 |
|
TP721236 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) |
USD 300.00 |
|
TP723425 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF). |
USD 140.00 |
{0} Product Review(s)
Be the first one to submit a review