NGF (NM_002506) Human Recombinant Protein

CAT#: TP723425

Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
• Tag: Tag Free
• Predicted MW: 13.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: determined by its ability to stimulate chick E9 DRG neurite outgrowth. ED50 is less than or equal to 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002497
• Locus ID: 4803
• UniProt ID: P01138
• Cytogenetics: 1p13.2
• Refseq Size: 1052
• Refseq ORF: 723
• Synonyms: Beta-NGF; HSAN5; NGFB
• Summary: 'This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Apoptosis, MAPK signaling pathway, Neurotrophin signaling pathway