LUC7L (NM_201412) Human Mass Spec Standard

CAT#: PH321529

LUC7L MS Standard C13 and N15-labeled recombinant protein (NP_958815)

Product Images

Coomassie blue staining of purified LUC7L protein (Cat# TP321529). The protein was produced from HEK293T cells transfected with LUC7L cDNA clone (Cat# RC221529) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221529
• Predicted MW: 43.5 kDa
• Protein Sequence:
  Sequence Link

  >RC221529 representing NM_201412
  Red=Cloning site Green=Tags(s)
  
  MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
  YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA
  EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
  GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS
  RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR
  LESSNGKMASRRSEEKEAGEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_958815
• RefSeq Size: 1452
• RefSeq ORF: 1113
• Synonyms: hLuc7B1; Luc7; LUC7B1; SR+89
• Locus ID: 55692
• UniProt ID: Q9NQ29
• Cytogenetics: 16p13.3
• Summary: The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]). [supplied by OMIM, Mar 2008]