ARMET (MANF) (NM_006010) Human Mass Spec Standard

CAT#: PH321555

MANF MS Standard C13 and N15-labeled recombinant protein (NP_006001)

Product Images

Coomassie blue staining of purified MANF protein (Cat# TP321555). The protein was produced from HEK293T cells transfected with MANF cDNA clone (Cat# RC221555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221555
• Predicted MW: 21.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221555 representing NM_006010
  Red=Cloning site Green=Tags(s)
  
  MRRMRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREA
  RGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRV
  KELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006001
• RefSeq Size: 993
• RefSeq ORF: 555
• Synonyms: ARMET; ARP
• Locus ID: 7873
• UniProt ID: P55145, A8K878
• Cytogenetics: 3p21.2
• Summary: The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this protein is important in promoting the survival of dopaminergic neurons. The presence of polymorphisms in the N-terminal arginine-rich region, including a specific mutation that changes an ATG start codon to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus no longer thought to be tumor-related. [provided by RefSeq, Apr 2014]
• Protein Families: Druggable Genome, Secreted Protein