Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against ARMET
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KFCREARGKENR, from the internal region of the protein sequence according to NP_006001.2. |
ARMET (MANF) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 19-48 amino acids from the N-terminal region of human ARMET / ARP |
Rabbit Polyclonal Anti-MANF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MANF antibody: synthetic peptide directed towards the C terminal of human MANF. Synthetic peptide located within the following region: EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK |
Rabbit Polyclonal Anti-MANF Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MANF |
ARMET/ARP/MANF Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-182 of human ARMET/ARP/MANF (NP_006001.4). |
| Modifications | Unmodified |
ARMET/ARP/MANF Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-182 of human ARMET/ARP/MANF (NP_006001.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MANF