ARMET (MANF) Rabbit Polyclonal Antibody

CAT#: TA342672

Rabbit Polyclonal Anti-MANF Antibody

Product Images

WB Suggested Anti-MANF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HCT15 cell lysate MANF is supported by BioGPS gene expression data to be expressed in HCT15

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MANF antibody: synthetic peptide directed towards the C terminal of human MANF. Synthetic peptide located within the following region: EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: mesencephalic astrocyte derived neurotrophic factor
• Database Link:
  NP_006001
  Entrez Gene 7873 Human
  UniProt ID P55145
• Background: MANF is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of MANF gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of polymorphisms in the arginine-rich region, including a specific mutation that changes the previously numbered codon 50 from ATG to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus not tumor-related.
• Synonyms: ARMET; ARP
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein