CED6 (GULP1) (NM_016315) Human Mass Spec Standard

CAT#: PH321580

GULP1 MS Standard C13 and N15-labeled recombinant protein (NP_057399)

Product Images

Coomassie blue staining of purified GULP1 protein (Cat# TP321580). The protein was produced from HEK293T cells transfected with GULP1 cDNA clone (Cat# RC221580) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221580
• Predicted MW: 34.3 kDa
• Protein Sequence:
  Sequence Link

  >RC221580 representing NM_016315
  Red=Cloning site Green=Tags(s)
  
  MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV
  ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLT
  IGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPK
  SPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEM
  QEGFKMGLTLEGTVFCLDPLDSRC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057399
• RefSeq Size: 3464
• RefSeq ORF: 912
• Synonyms: CED-6; CED6; GULP
• Locus ID: 51454
• UniProt ID: Q9UBP9
• Cytogenetics: 2q32.1-q32.2
• Summary: The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. [provided by RefSeq, Nov 2011]
• Protein Families: Druggable Genome