MAP2 (NM_031845) Human Mass Spec Standard

CAT#: PH321637

MAP2 MS Standard C13 and N15-labeled recombinant protein (NP_114033)

Product Images

Coomassie blue staining of purified MAP2 protein (Cat# TP321637). The protein was produced from HEK293T cells transfected with MAP2 cDNA clone (Cat# RC221637) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221637
• Predicted MW: 49.5 kDa
• Protein Sequence:
  Sequence Link

  >RC221637 representing NM_031845
  Red=Cloning site Green=Tags(s)
  
  MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNT
  KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAEETANLPPSPPPSP
  ASEQTVTVEEAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNS
  SISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAIL
  VPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSK
  CGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAE
  IITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114033
• RefSeq Size: 2466
• RefSeq ORF: 254
• Synonyms: MAP-2; MAP2A; MAP2B; MAP2C
• Locus ID: 4133
• UniProt ID: P11137, A0A024R409
• Cytogenetics: 2q34
• Summary: 'This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2010]'
• Protein Families: Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS