OSCAR (NM_130771) Human Mass Spec Standard

CAT#: PH321675

OSCAR MS Standard C13 and N15-labeled recombinant protein (NP_570127)

Product Images

Coomassie blue staining of purified OSCAR protein (Cat# TP321675). The protein was produced from HEK293T cells transfected with OSCAR cDNA clone (Cat# RC221675) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221675
• Predicted MW: 29 kDa
• Protein Sequence:
  Sequence Link

  >RC221675 representing NM_130771
  Red=Cloning site Green=Tags(s)
  
  MALVLILQLLTLWPLCHTDITPSVAIIVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFK
  PGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALP
  GPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVL
  SQRSEVLVISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_570127
• RefSeq Size: 1440
• RefSeq ORF: 801
• Synonyms: PIgR-3; PIGR3
• Locus ID: 126014
• UniProt ID: Q8IYS5, A0A087X1R2
• Cytogenetics: 19q13.42
• Summary: Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome