ZAR1 (NM_175619) Human Mass Spec Standard

CAT#: PH321731

ZAR1 MS Standard C13 and N15-labeled recombinant protein (NP_783318)

Product Images

Coomassie blue staining of purified ZAR1 protein (Cat# TP321731). The protein was produced from HEK293T cells transfected with ZAR1 cDNA clone (Cat# RC221731) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221731
• Predicted MW: 45.7 kDa
• Protein Sequence:
  Sequence Link

  >RC221731 representing NM_175619
  Red=Cloning site Green=Tags(s)
  
  MAALGDEVLDGYVFPACPPCSYRYPYPAATKGKGAAGGSWQQRGRGCLPASSPCSAGAASLSFPGCGRLT
  AAEYFDSYQRERLMALLAQVGPGLGPRARRAGSCDVAVQVSPRIDAAVQCSLGRRTLQRRARDPESPAGP
  GAEGTTGGGSFSQQPSRRGLEQGSPQNGAPRPMRFPRTVAVYSPLALRRLTAFLEGPGPAAGEQRSGASD
  GERGPPPARLQGPEEGEVWTKKAPRRPQSDDDGEAQAAVRASWEQPADGPELPPREAQEGEAAPRSALRS
  PGQPPSAGRARDGGDGREAAVAGEGPSPRSPELGKERLRFQFLEQKYGYYHCKDCNIRWESAYVWCVQGT
  NKVYFKQFCRTCQKSYNPYRVEDITCQSCKQTRCSCPVKLRHVDPKRPHRQDLCGRCKGKRLSCDSTFSF
  KYII
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_783318
• RefSeq Size: 1438
• RefSeq ORF: 1272
• Synonyms: Z3CXXC6
• Locus ID: 326340
• UniProt ID: Q86SH2, B9EG67
• Cytogenetics: 4p11
• Summary: This maternal effect gene is oocyte-specific and encodes a protein that is thought to function in the initiation of embryogenesis. A similar protein in mouse is required for female fertility. [provided by RefSeq, Jul 2013]