FUSIP1 (SRSF10) (NM_006625) Human Mass Spec Standard

CAT#: PH321759

SFRS13A MS Standard C13 and N15-labeled recombinant protein (NP_006616)

Product Images

Coomassie blue staining of purified SRSF10 protein (Cat# TP321759). The protein was produced from HEK293T cells transfected with SRSF10 cDNA clone (Cat# RC221759) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221759
• Predicted MW: 22.2 kDa
• Protein Sequence:
  Sequence Link

  >RC221759 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
  LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR
  SYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006616
• RefSeq Size: 4076
• RefSeq ORF: 549
• Synonyms: FUSIP1; FUSIP2; NSSR; PPP1R149; SFRS13; SFRS13A; SRp38; SRrp40; TASR; TASR1; TASR2
• Locus ID: 10772
• UniProt ID: O75494
• Cytogenetics: 1p36.11
• Summary: This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Transcription Factors
• Protein Pathways: Spliceosome