CD44 (NM_000610) Human Mass Spec Standard
CAT#: PH321771
CD44 MS Standard C13 and N15-labeled recombinant protein (NP_000601)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221771 |
| Predicted MW | 81.54 kDa |
| Protein Sequence |
>RC221771 representing NM_000610
Red=Cloning site Green=Tags(s) MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFD GPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP WITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE ENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRN GTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTG LVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGY TSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGS QEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLN GEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000601 |
| RefSeq Size | 5748 |
| RefSeq ORF | 2226 |
| Synonyms | CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1 |
| Locus ID | 960 |
| UniProt ID | P16070 |
| Cytogenetics | 11p13 |
| Summary | 'The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. [provided by RefSeq, Jul 2008]' |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane |
| Protein Pathways | ECM-receptor interaction, Hematopoietic cell lineage |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400203 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC424332 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424334 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425023 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400203 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 1 |
USD 665.00 |
|
| LY424332 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 2 |
USD 436.00 |
|
| LY424334 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 4 |
USD 436.00 |
|
| LY425023 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 2 |
USD 605.00 |
|
| PH302455 | CD44 MS Standard C13 and N15-labeled recombinant protein (NP_001001389) |
USD 2,055.00 |
|
| TP302455 | Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 2 |
USD 867.00 |
|
| TP321771 | Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 1 |
USD 748.00 |
|
| TP720465 | Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China