FCRL2 (NM_030764) Human Mass Spec Standard
CAT#: PH321878
FCRL2 MS Standard C13 and N15-labeled recombinant protein (NP_110391)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221878 |
Predicted MW | 53.4 kDa |
Protein Sequence |
>RC221878 representing NM_030764
Red=Cloning site Green=Tags(s) MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQ SAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQ LQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIR APGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNG HVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGG GASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYA LFHKISGESSATNEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSQVWSMQQPESSANIR TLLENKDSQVIYSSVKKS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_110391 |
RefSeq Size | 2573 |
RefSeq ORF | 1524 |
Synonyms | CD307b; FCRH2; IFGP4; IRTA4; SPAP1; SPAP1A; SPAP1B; SPAP1C |
Locus ID | 79368 |
UniProt ID | Q96LA5, B4E0W2 |
Cytogenetics | 1q23.1 |
Summary | This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Apr 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408502 | FCRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410726 | FCRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY408502 | Transient overexpression lysate of Fc receptor-like 2 (FCRL2), transcript variant 1 |
USD 396.00 |
|
LY410726 | Transient overexpression lysate of Fc receptor-like 2 (FCRL2) |
USD 605.00 |
|
TP321878 | Recombinant protein of human Fc receptor-like 2 (FCRL2), transcript variant 2 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review