CUG BP1 (CELF1) (NM_198700) Human Mass Spec Standard
CAT#: PH321943
CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_941989)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221943 |
Predicted MW | 51.6 kDa |
Protein Sequence |
>RC221943 protein sequence
Red=Cloning site Green=Tags(s) MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_941989 |
RefSeq Size | 4656 |
RefSeq ORF | 1449 |
Synonyms | BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR |
Locus ID | 10658 |
UniProt ID | Q92879 |
Cytogenetics | 11p11.2 |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401964 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404819 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422453 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC433163 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC433208 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401964 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1 |
USD 396.00 |
|
LY404819 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2 |
USD 605.00 |
|
LY422453 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 3 |
USD 605.00 |
|
LY433163 | Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 5 |
USD 396.00 |
|
LY433208 | Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 4 |
USD 396.00 |
|
PH306275 | CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_006551) |
USD 2,055.00 |
|
TP306275 | Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1 |
USD 867.00 |
|
TP321943 | Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review