Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) (NM_016141) Human Mass Spec Standard

CAT#: PH322010

DYNC1LI1 MS Standard C13 and N15-labeled recombinant protein (NP_057225)

Product Images

Coomassie blue staining of purified DYNC1LI1 protein (Cat# TP322010). The protein was produced from HEK293T cells transfected with DYNC1LI1 cDNA clone (Cat# RC222010) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222010
• Predicted MW: 56.6 kDa
• Protein Sequence:
  Sequence Link

  >RC222010 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNV
  LLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVS
  LKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQR
  RNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGA
  ALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE
  DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
  SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQK
  PVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057225
• RefSeq Size: 2517
• RefSeq ORF: 1569
• Synonyms: DLC-A; DNCLI1; LIC1
• Locus ID: 51143
• UniProt ID: Q9Y6G9
• Cytogenetics: 3p22.3
• Summary: The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016]