plasticity related gene 3 (PLPPR1) (NM_207299) Human Mass Spec Standard

CAT#: PH322205

LPPR1 MS Standard C13 and N15-labeled recombinant protein (NP_997182)

Product Images

Coomassie blue staining of purified PLPPR1 protein (Cat# TP322205). The protein was produced from HEK293T cells transfected with PLPPR1 cDNA clone (Cat# RC222205) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222205
• Predicted MW: 35.8 kDa
• Protein Sequence:
  Sequence Link

  >RC222205 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP
  LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI
  FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY
  ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK
  GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997182
• RefSeq Size: 2461
• RefSeq ORF: 975
• Synonyms: LPPR1; PRG-3
• Locus ID: 54886
• UniProt ID: Q8TBJ4, A0A024R154
• Cytogenetics: 9q31.1
• Summary: This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
• Protein Families: Phosphatase, Transmembrane