PACRG (NM_001080378) Human Mass Spec Standard

CAT#: PH322240

PACRG MS Standard C13 and N15-labeled recombinant protein (NP_001073847)

Product Images

Coomassie blue staining of purified PACRG protein (Cat# TP322240). The protein was produced from HEK293T cells transfected with PACRG cDNA clone (Cat# RC222240) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222240
• Predicted MW: 29.3 kDa
• Protein Sequence:
  Sequence Link

  >RC222240 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPT
  AFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGN
  KILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDG
  IDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073847
• RefSeq Size: 1585
• RefSeq ORF: 771
• Synonyms: GLUP; HAK005771; PACRG2.1; PARK2CRG
• Locus ID: 135138
• UniProt ID: Q96M98
• Cytogenetics: 6q26
• Summary: This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome