Flt3 ligand (FLT3LG) (NM_001459) Human Mass Spec Standard

CAT#: PH322242

FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450)

Product Images

Coomassie blue staining of purified FLT3LG protein (Cat# TP322242). The protein was produced from HEK293T cells transfected with FLT3LG cDNA clone (Cat# RC222242) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222242
• Predicted MW: 26.4 kDa
• Protein Sequence:
  Sequence Link

  >RC222242 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC
  GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA
  LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT
  RRRTPRPGEQVPPVPSPQDLLLVEH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001450
• RefSeq Size: 1074
• RefSeq ORF: 705
• Synonyms: FL; FLG3L; FLT3L
• Locus ID: 2323
• UniProt ID: P49771
• Cytogenetics: 19q13.33
• Summary: 'Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer