Calpastatin (CAST) (NM_173061) Human Mass Spec Standard
CAT#: PH322278
CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222278 |
Predicted MW | 46.9 kDa |
Protein Sequence |
>RC222278 representing NM_173061
Red=Cloning site Green=Tags(s) MGQFLSSTFLEGSPATVWHDKLCDGERRGAREAVRIFQDQAKAKEEKLEKCGEDDETIPSEYRLKPATDK DGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQS APPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVK DKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPP RDTSSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQD KPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKT TEETSKPKDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_775084 |
RefSeq Size | 1889 |
RefSeq ORF | 1290 |
Synonyms | BS-17; calpain inhibitor; calpastatin; heart-type calpastatin; MGC9402; OTTHUMP00000158519; OTTHUMP00000158520; sperm BS-17 component |
Locus ID | 831 |
Cytogenetics | 5q15 |
Summary | 'The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430374 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 |
USD 495.00 |
|
LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
USD 495.00 |
|
LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 |
USD 325.00 |
|
LY430374 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
USD 495.00 |
|
LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 |
USD 495.00 |
|
PH302168 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) |
USD 2,055.00 |
|
PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) |
USD 2,055.00 |
|
TP302168 | Recombinant protein of human calpastatin (CAST), transcript variant 10 |
USD 867.00 |
|
TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1 |
USD 823.00 |
|
TP322278 | Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review