Calpastatin (CAST) (NM_001042444) Human Recombinant Protein
CAT#: TP302168
Recombinant protein of human calpastatin (CAST), transcript variant 10
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202168 protein sequence
Red=Cloning site Green=Tags(s) MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGG ESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPE VSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKT EKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAK EEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK TEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEK AKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFE DAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKA EHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNT AKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035909 |
Locus ID | 831 |
UniProt ID | P20810 |
Cytogenetics | 5q15 |
Refseq Size | 4366 |
Refseq ORF | 2001 |
Synonyms | BS-17; PLACK |
Summary | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430374 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 |
USD 605.00 |
|
LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
USD 605.00 |
|
LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 |
USD 396.00 |
|
LY430374 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
USD 605.00 |
|
LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 |
USD 605.00 |
|
PH302168 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) |
USD 2,055.00 |
|
PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) |
USD 2,055.00 |
|
PH322278 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084) |
USD 2,055.00 |
|
TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1 |
USD 823.00 |
|
TP322278 | Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review