CKII alpha (CSNK2A1) (NM_001895) Human Mass Spec Standard

CAT#: PH322302

CSNK2A1 MS Standard C13 and N15-labeled recombinant protein (NP_001886)

Product Images

Coomassie blue staining of purified CSNK2A1 protein (Cat# TP322302). The protein was produced from HEK293T cells transfected with CSNK2A1 cDNA clone (Cat# RC222302) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222302
• Predicted MW: 45 kDa
• Protein Sequence:
  Sequence Link

  >RC222302 representing NM_001895
  Red=Cloning site Green=Tags(s)
  
  MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL
  KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI
  LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD
  YSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKR
  WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN
  MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001886
• RefSeq Size: 2732
• RefSeq ORF: 1173
• Synonyms: CK2A1; Cka1; Cka2; CKII; OCNDS
• Locus ID: 1457
• UniProt ID: P68400
• Cytogenetics: 20p13
• Summary: 'Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythm. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. Multiple transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Apr 2018]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
• Protein Pathways: Adherens junction, Tight junction, Wnt signaling pathway