kynurenine 3 monooxygenase (KMO) (NM_003679) Human Mass Spec Standard
CAT#: PH322594
KMO MS Standard C13 and N15-labeled recombinant protein (NP_003670)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222594 |
Predicted MW | 55.6 kDa |
Protein Sequence |
>RC222594 representing NM_003679
Red=Cloning site Green=Tags(s) MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK VINKGLFFLGSLIAISSTYLLIHYMSPRSFLCLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003670 |
RefSeq Size | 4992 |
RefSeq ORF | 1458 |
Synonyms | dJ317G22.1 |
Locus ID | 8564 |
UniProt ID | O15229, A8K693 |
Cytogenetics | 1q43 |
Summary | This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401216 | KMO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY401216 | Transient overexpression lysate of kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO) |
USD 495.00 |
|
TP322594 | Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO) |
USD 788.00 |
|
TP700071 | Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with C-terminal AVI tag (GGGLNDIFEAQKIEWHE) prior to MYC/DDK tag, expressed in human cells, 20ug |
USD 748.00 |
|
TP700072 | Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with N-terminal AVI tag (MSGLNDIFEAQKIEWHEAIA) and C-terminal MYC/DDK tag, expressed in human cells, 20ug |
USD 748.00 |
|
TP710125 | Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review