PKMYT1 (NM_004203) Human Mass Spec Standard

CAT#: PH322657

PKMYT1 MS Standard C13 and N15-labeled recombinant protein (NP_004194)

Product Images

Coomassie blue staining of purified PKMYT1 protein (Cat# TP322657). The protein was produced from HEK293T cells transfected with PKMYT1 cDNA clone (Cat# RC222657) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222657
• Predicted MW: 54.3 kDa
• Protein Sequence:
  Sequence Link

  >RC222657 representing NM_004203
  Red=Cloning site Green=Tags(s)
  
  MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPR
  TPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKR
  SMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQV
  WGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQ
  GSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA
  EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
  LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLS
  LFEDTLDPT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004194
• RefSeq Size: 2121
• RefSeq ORF: 1497
• Synonyms: MYT1; PPP1R126
• Locus ID: 9088
• UniProt ID: Q99640, Q0IJ49
• Cytogenetics: 16p13.3
• Summary: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. The activity of the encoded protein is regulated by polo-like kinase 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation