TFIIS (TCEA2) (NM_003195) Human Mass Spec Standard

CAT#: PH322661

TCEA2 MS Standard C13 and N15-labeled recombinant protein (NP_003186)

Product Images

Coomassie blue staining of purified TCEA2 protein (Cat# TP322661). The protein was produced from HEK293T cells transfected with TCEA2 cDNA clone (Cat# RC222661) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222661
• Predicted MW: 33.6 kDa
• Protein Sequence:
  Sequence Link

  >RC222661 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAK
  SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITTFPPVPVTCDAVRN
  KCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLC
  GAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSD
  EPMTTFVVCNECGNRWKFC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003186
• RefSeq Size: 1749
• RefSeq ORF: 897
• Synonyms: TFIIS
• Locus ID: 6919
• UniProt ID: Q15560, Q6IB64
• Cytogenetics: 20q13.33
• Summary: 'The protein encoded by this gene is found in the nucleus, where it functions as an SII class transcription elongation factor. Elongation factors in this class are responsible for releasing RNA polymerase II ternary complexes from transcriptional arrest at template-encoded arresting sites. The encoded protein has been shown to interact with general transcription factor IIB, a basal transcription factor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors