Sumo 2 (SUMO2) (NM_001005849) Human Mass Spec Standard

CAT#: PH322664

SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005849)

Product Images

Coomassie blue staining of purified SUMO2 protein (Cat# TP322664). The protein was produced from HEK293T cells transfected with SUMO2 cDNA clone (Cat# RC222664) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222664
• Predicted MW: 7.9 kDa
• Protein Sequence:
  Sequence Link

  >RC222664 representing NM_001005849
  Red=Cloning site Green=Tags(s)
  
  MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQLEMEDEDTIDVFQQQTGGV
  Y
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001005849
• RefSeq Size: 994
• RefSeq ORF: 213
• Synonyms: HSMT3; Smt3A; SMT3B; SMT3H2; SUMO3
• Locus ID: 6613
• UniProt ID: P61956
• Cytogenetics: 17q25.1
• Summary: 'This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome