FSH beta (FSHB) (NM_000510) Human Mass Spec Standard

CAT#: PH322666

FSHB MS Standard C13 and N15-labeled recombinant protein (NP_000501)

Product Images

Coomassie blue staining of purified FSHB protein (Cat# TP322666). The protein was produced from HEK293T cells transfected with FSHB cDNA clone (Cat# RC222666) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222666
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Sequence Link

  >RC222666 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT
  FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000501
• RefSeq Size: 1936
• RefSeq ORF: 387
• Synonyms: HH24
• Locus ID: 2488
• UniProt ID: P01225, A0A0F7RQE8
• Cytogenetics: 11p14.1
• Summary: 'The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway, Neuroactive ligand-receptor interaction