PKM2 (PKM) (NM_182471) Human Mass Spec Standard
CAT#: PH322698
PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872271)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222698 |
Predicted MW | 57.9 kDa |
Protein Sequence |
>RC222698 representing NM_182471
Red=Cloning site Green=Tags(s) MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_872271 |
RefSeq Size | 2498 |
RefSeq ORF | 1593 |
Synonyms | CTHBP; HEL-S-30; OIP3; PK3; PKM2; TCB; THBP1 |
Locus ID | 5315 |
UniProt ID | P14618, A0A024R5Z9 |
Cytogenetics | 15q23 |
Summary | 'This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported. [provided by RefSeq, May 2011]' |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405537 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC405538 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC419188 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405537 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 2 |
USD 605.00 |
|
LY405538 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 3 |
USD 605.00 |
|
LY419188 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 1 |
USD 396.00 |
|
PH301855 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_002645) |
USD 2,055.00 |
|
PH319382 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872270) |
USD 2,055.00 |
|
TP301855 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 1 |
USD 867.00 |
|
TP319382 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 2 |
USD 748.00 |
|
TP322698 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 3 |
USD 748.00 |
|
TP721212 | Purified recombinant protein of Human pyruvate kinase, muscle (PKM2), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review