THYN1 (NM_199297) Human Mass Spec Standard

CAT#: PH322714

THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994)

Product Images

Coomassie blue staining of purified THYN1 protein (Cat# TP322714). The protein was produced from HEK293T cells transfected with THYN1 cDNA clone (Cat# RC222714) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222714
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC222714 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG
  VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF
  EKNNPHYDPSSKEDNPKWSMKSLILF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954994
• RefSeq Size: 862
• RefSeq ORF: 498
• Synonyms: HSPC144; MDS012; MY105; THY28; THY28KD
• Locus ID: 29087
• UniProt ID: Q9P016
• Cytogenetics: 11q25
• Summary: This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]