PUS1 (NM_001002020) Human Mass Spec Standard
CAT#: PH322753
PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002020)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222753 |
Predicted MW | 44.4 kDa |
Protein Sequence |
>RC222753 protein sequence
Red=Cloning site Green=Tags(s) MAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLKSGGDEERREKPPKRKIVLLMAYSGKGYH GMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDDILE KINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLAC YKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGY APESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTII GTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001002020 |
RefSeq Size | 1666 |
RefSeq ORF | 1197 |
Synonyms | MLASA1 |
Locus ID | 80324 |
UniProt ID | Q9Y606, E5KMT6 |
Cytogenetics | 12q24.33 |
Summary | This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410839 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424322 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424323 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425071 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410839 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 1 |
USD 396.00 |
|
LY424322 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 2 |
USD 396.00 |
|
LY424323 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 |
USD 396.00 |
|
LY425071 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 |
USD 396.00 |
|
PH300879 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491) |
USD 2,055.00 |
|
PH302637 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002019) |
USD 2,055.00 |
|
TP300879 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 1 |
USD 823.00 |
|
TP302637 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 2 |
USD 823.00 |
|
TP322753 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review