PUS1 (NM_025215) Human Recombinant Protein
CAT#: TP300879
Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200879 protein sequence
Red=Cloning site Green=Tags(s) MGLQLRALLGAFGRWTLRLGPRPSCSPRMAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLK SGGDEERREKPPKRKIVLLMAYSGKGYHGMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQ RCARTDKGVSAAGQVVSLKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAF AHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFA VIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGND GLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGS EGDGDTD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079491 |
Locus ID | 80324 |
UniProt ID | Q9Y606, E5KMT5 |
Cytogenetics | 12q24.33 |
Refseq Size | 2014 |
Refseq ORF | 1281 |
Synonyms | MLASA1 |
Summary | This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410839 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424322 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424323 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425071 | PUS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410839 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 1 |
USD 325.00 |
|
LY424322 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 2 |
USD 325.00 |
|
LY424323 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 |
USD 325.00 |
|
LY425071 | Transient overexpression lysate of pseudouridylate synthase 1 (PUS1), transcript variant 3 |
USD 325.00 |
|
PH300879 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_079491) |
USD 2,055.00 |
|
PH302637 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002019) |
USD 2,055.00 |
|
PH322753 | PUS1 MS Standard C13 and N15-labeled recombinant protein (NP_001002020) |
USD 2,055.00 |
|
TP302637 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 2 |
USD 823.00 |
|
TP322753 | Recombinant protein of human pseudouridylate synthase 1 (PUS1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review