MCK10 (DDR1) (NM_013993) Human Mass Spec Standard
CAT#: PH322767
DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054699)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222767 |
| Predicted MW | 100.9 kDa |
| Protein Sequence |
>RC222767 representing NM_013993
Red=Cloning site Green=Tags(s) MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL NTV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_054699 |
| RefSeq Size | 3877 |
| RefSeq ORF | 2739 |
| Synonyms | CAK; CD167; DDR; EDDR1; HGK2; MCK10; NEP; NTRK4; PTK3; PTK3A; RTK6; TRKE |
| Locus ID | 780 |
| UniProt ID | Q08345, A0A024RCL1 |
| Cytogenetics | 6p21.33 |
| Summary | 'Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of tyrosine kinase receptors with homology to Dictyostelium discoideum protein discoidin I in their extracellular domain, and that are activated by various types of collagen. Expression of this protein is restricted to epithelial cells, particularly in the kidney, lung, gastrointestinal tract, and brain. In addition, it has been shown to be significantly overexpressed in several human tumors. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011]' |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400719 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC415575 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC415576 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429403 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429404 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400719 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2 |
USD 436.00 |
|
| LY415575 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1 |
USD 665.00 |
|
| LY415576 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3 |
USD 605.00 |
|
| LY429403 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1 |
USD 605.00 |
|
| LY429404 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3 |
USD 605.00 |
|
| PH322819 | DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054700) |
USD 2,055.00 |
|
| TP322767 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1 |
USD 788.00 |
|
| TP322819 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3 |
USD 748.00 |
|
| TP700161 | Purified recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP710141 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, residues 21-417aa, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
| TP710264 | Purified recombinant protein of Human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China