p38 (MAPK14) (NM_139014) Human Mass Spec Standard
CAT#: PH322774
MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620583)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222774 |
Predicted MW | 35.3 kDa |
Protein Sequence |
>RC222774 representing NM_139014
Red=Cloning site Green=Tags(s) MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESLSTCWRRCLYWTQIRELQRPKPLHMP TLLSTTILMMNQWPILMISPLKAGTSL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620583 |
RefSeq Size | 3679 |
RefSeq ORF | 921 |
Synonyms | CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; p38; p38ALPHA; PRKM14; PRKM15; RK; SAPK2A |
Locus ID | 1432 |
UniProt ID | Q16539 |
Cytogenetics | 6p21.31 |
Summary | 'The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400523 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408439 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408440 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430080 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400523 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 1 |
USD 396.00 |
|
LY408439 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 2 |
USD 396.00 |
|
LY408440 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 3 |
USD 396.00 |
|
LY430080 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 3 |
USD 396.00 |
|
PH306605 | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620581) |
USD 2,055.00 |
|
PH317425 | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_001306) |
USD 2,055.00 |
|
TP306605 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 2 |
USD 823.00 |
|
TP317425 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 1 |
USD 748.00 |
|
TP322774 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review