PPM1B (NM_177968) Human Mass Spec Standard

CAT#: PH322782

PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808907)

Product Images

Coomassie blue staining of purified PPM1B protein (Cat# TP322782). The protein was produced from HEK293T cells transfected with PPM1B cDNA clone (Cat# RC222782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222782
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC222782 representing NM_177968
  Red=Cloning site Green=Tags(s)
  
  MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY
  CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS
  PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV
  DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL
  HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL
  PPGGGLAGKRNVIEAVYSRLNPHRESDGGAGDLEDPW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_808907
• RefSeq Size: 3850
• RefSeq ORF: 1161
• Synonyms: PP2C-beta; PP2C-beta-X; PP2CB; PP2CBETA; PPC2BETAX
• Locus ID: 5495
• UniProt ID: O75688
• Cytogenetics: 2p21
• Summary: 'The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Phosphatase, Stem cell - Pluripotency
• Protein Pathways: MAPK signaling pathway