CBWD1 (NM_018491) Human Mass Spec Standard

CAT#: PH322790

CBWD1 MS Standard C13 and N15-labeled recombinant protein (NP_060961)

Product Images

Coomassie blue staining of purified CBWD1 protein (Cat# TP322790). The protein was produced from HEK293T cells transfected with CBWD1 cDNA clone (Cat# RC222790) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222790
• Predicted MW: 43.9 kDa
• Protein Sequence:
  Sequence Link

  >RC222790 representing NM_018491
  Red=Cloning site Green=Tags(s)
  
  MLPAVGSADEEEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILTEQHSKR
  VAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGL
  ADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPE
  EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFE
  VPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDD
  TERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTTRFQEDQVCT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060961
• RefSeq Size: 1680
• RefSeq ORF: 1185
• Synonyms: COBP
• Locus ID: 55871
• UniProt ID: Q9BRT8
• Cytogenetics: 9p24.3
• Summary: Belongs to the SIMIBI class G3E GTPase family. CobW subfamily. [UniProtKB/Swiss-Prot Function]