MEIS2 (NM_170677) Human Mass Spec Standard

CAT#: PH322807

MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777)

Product Images

Coomassie blue staining of purified MEIS2 protein (Cat# TP322807). The protein was produced from HEK293T cells transfected with MEIS2 cDNA clone (Cat# RC222807) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222807
• Predicted MW: 43.6 kDa
• Protein Sequence:
  Sequence Link

  >RC222807 representing NM_170677
  Red=Cloning site Green=Tags(s)
  
  MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVN
  DALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSN
  PELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNL
  ADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKR
  GIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLD
  PSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_733777
• RefSeq Size: 3721
• RefSeq ORF: 1203
• Synonyms: CPCMR; HsT18361; MRG1
• Locus ID: 4212
• UniProt ID: O14770, B3KPD8
• Cytogenetics: 15q14
• Summary: 'This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors