NUDT9 (NM_024047) Human Mass Spec Standard
CAT#: PH322894
NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_076952)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222894 |
| Predicted MW | 38.9 kDa |
| Protein Sequence |
>RC222894 representing NM_024047
Red=Cloning site Green=Tags(s) MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_076952 |
| RefSeq Size | 1716 |
| RefSeq ORF | 1050 |
| Synonyms | NUDT10 |
| Locus ID | 53343 |
| UniProt ID | Q9BW91, Q96KB3 |
| Cytogenetics | 4q22.1 |
| Summary | The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Ion Channels: Other |
| Protein Pathways | Purine metabolism |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402975 | NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC405100 | NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402975 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 |
USD 436.00 |
|
| LY405100 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3 |
USD 436.00 |
|
| PH300952 | NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155) |
USD 2,055.00 |
|
| TP300952 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3 |
USD 823.00 |
|
| TP322894 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China