CYP27A1 (NM_000784) Human Mass Spec Standard

CAT#: PH322953

CYP27A1 MS Standard C13 and N15-labeled recombinant protein (NP_000775)

Product Images

Coomassie blue staining of purified CYP27A1 protein (Cat# TP322953). The protein was produced from HEK293T cells transfected with CYP27A1 cDNA clone (Cat# RC222953) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222953
• Predicted MW: 60.26 kDa
• Protein Sequence:
  Sequence Link

  >RC222953 representing NM_000784
  Red=Cloning site Green=Tags(s)
  
  MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFF
  QLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQH
  DLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMVQLFY
  YFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFS
  FGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYH
  LSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
  NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLL
  ARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000775
• RefSeq Size: 2059
• RefSeq ORF: 1593
• Synonyms: CP27; CTX; CYP27
• Locus ID: 1593
• UniProt ID: Q02318
• Cytogenetics: 2q35
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, P450
• Protein Pathways: Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis