HIST3H2BB (NM_175055) Human Mass Spec Standard

CAT#: PH322960

HIST3H2BB MS Standard C13 and N15-labeled recombinant protein (NP_778225)

Product Images

Coomassie blue staining of purified HIST3H2BB protein (Cat# TP322960). The protein was produced from HEK293T cells transfected with HIST3H2BB cDNA clone (Cat# RC222960) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222960
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC222960 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
  FERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_778225
• RefSeq Size: 452
• RefSeq ORF: 378
• Synonyms: H2Bb
• Locus ID: 128312
• UniProt ID: Q8N257
• Cytogenetics: 1q42.13
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015]
• Protein Pathways: Systemic lupus erythematosus