TRAF4AF1 (KNSTRN) (NM_033286) Human Mass Spec Standard

CAT#: PH322981

C15orf23 MS Standard C13 and N15-labeled recombinant protein (NP_150628)

Product Images

Coomassie blue staining of purified KNSTRN protein (Cat# TP322981). The protein was produced from HEK293T cells transfected with KNSTRN cDNA clone (Cat# RC222981) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222981
• Predicted MW: 35.4 kDa
• Protein Sequence:
  Sequence Link

  >RC222981 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQEADLAGGTTVAAGNLLNESEKDCGQDRRAPG
  VQPCLLVTMTSVVKTVYSLQPSSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK
  LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL
  EKFRDNCLAILESKGLDPALGGETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL
  EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150628
• RefSeq Size: 1763
• RefSeq ORF: 948
• Synonyms: C15orf23; HSD11; SKAP; TRAF4AF1
• Locus ID: 90417
• UniProt ID: Q9Y448
• Cytogenetics: 15q15.1