STARD4 (NM_139164) Human Mass Spec Standard

CAT#: PH323123

STARD4 MS Standard C13 and N15-labeled recombinant protein (NP_631903)

Product Images

Coomassie blue staining of purified STARD4 protein (Cat# TP323123). The protein was produced from HEK293T cells transfected with STARD4 cDNA clone (Cat# RC223123) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223123
• Predicted MW: 23.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223123 representing NM_139164
  Red=Cloning site Green=Tags(s)
  
  MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHI
  RPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDE
  KRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_631903
• RefSeq Size: 2264
• RefSeq ORF: 615
• Synonyms: 4632419C16Rik; 9030213J02Rik; AA517649; AW324468; StAR-related lipid transfer (START) domain containing 4; StAR-related lipid transfer protein 4
• Locus ID: 134429
• UniProt ID: Q96DR4
• Cytogenetics: 5q22.1
• Summary: Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]). [supplied by OMIM, Mar 2008]