PEAMT (PEMT) (NM_007169) Human Mass Spec Standard

CAT#: PH323190

PEMT MS Standard C13 and N15-labeled recombinant protein (NP_009100)

Product Images

Coomassie blue staining of purified PEMT protein (Cat# TP323190). The protein was produced from HEK293T cells transfected with PEMT cDNA clone (Cat# RC223190) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223190
• Predicted MW: 22 kDa
• Protein Sequence:
  Sequence Link

  >RC223190 representing NM_007169
  Red=Cloning site Green=Tags(s)
  
  MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTILLLNFLRSHC
  FTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGDYFGILKEARVTVFPFNILDN
  PMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009100
• RefSeq Size: 1008
• RefSeq ORF: 597
• Synonyms: PEAMT; PEMPT; PEMT2; PLMT; PNMT
• Locus ID: 10400
• UniProt ID: Q9UBM1
• Cytogenetics: 17p11.2
• Summary: Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells converts intracellular choline to phosphatidylcholine by a three-step process. The protein isoforms encoded by this gene localize to the endoplasmic reticulum and mitochondria-associated membranes. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2012]
• Protein Families: Transmembrane
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways