RANBP1 (NM_002882) Human Mass Spec Standard

CAT#: PH323305

RANBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002873)

Product Images

Coomassie blue staining of purified RANBP1 protein (Cat# TP323305). The protein was produced from HEK293T cells transfected with RANBP1 cDNA clone (Cat# RC223305) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223305
• Predicted MW: 23.1 kDa
• Protein Sequence:
  Sequence Link

  >RC223305 representing NM_002882
  Red=Cloning site Green=Tags(s)
  
  MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKER
  GTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAI
  RFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002873
• RefSeq Size: 884
• RefSeq ORF: 603
• Synonyms: HTF9A
• Locus ID: 5902
• UniProt ID: P04049, P43487, L7RRS6, A0A140VK94
• Cytogenetics: 22q11.21
• Summary: 'This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into the nucleus. There are multiple pseudogenes for this gene on chromosomes 9, 12, 17, and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]'