Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Mass Spec Standard

CAT#: PH323306

KRTDAP MS Standard C13 and N15-labeled recombinant protein (NP_997275)

Product Images

Coomassie blue staining of purified KRTDAP protein (Cat# TP323306). The protein was produced from HEK293T cells transfected with KRTDAP cDNA clone (Cat# RC223306) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223306
• Predicted MW: 11 kDa
• Protein Sequence:
  Sequence Link

  >RC223306 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF
  ESIKRKLPFLNWDAFPKLKGLRSATPDAQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997275
• RefSeq Size: 500
• RefSeq ORF: 297
• Synonyms: KDAP; UNQ467
• Locus ID: 388533
• UniProt ID: P60985
• Cytogenetics: 19q13.12
• Summary: This gene encodes a protein which may function in the regulation of keratinocyte differentiation and maintenance of stratified epithelia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]