C11orf17 (AKIP1) (NM_020642) Human Mass Spec Standard

CAT#: PH323315

C11orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065693)

Product Images

Coomassie blue staining of purified AKIP1 protein (Cat# TP323315). The protein was produced from HEK293T cells transfected with AKIP1 cDNA clone (Cat# RC223315) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223315
• Predicted MW: 22.9 kDa
• Protein Sequence:
  Sequence Link

  >RC223315 representing NM_020642
  Red=Cloning site Green=Tags(s)
  
  MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRV
  LPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDR
  KKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065693
• RefSeq Size: 1332
• RefSeq ORF: 630
• Synonyms: BCA3; C11orf17
• Locus ID: 56672
• UniProt ID: Q9NQ31
• Cytogenetics: 11p15.4
• Summary: This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]