C11orf17 (AKIP1) (NM_020642) Human Recombinant Protein
CAT#: TP323315
Recombinant protein of human chromosome 11 open reading frame 17 (C11orf17), transcript variant 1
View other "AKIP1" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223315 representing NM_020642
Red=Cloning site Green=Tags(s) MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRV LPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDR KKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065693 |
Locus ID | 56672 |
UniProt ID | Q9NQ31 |
Cytogenetics | 11p15.4 |
Refseq Size | 1332 |
Refseq ORF | 630 |
Synonyms | BCA3; C11orf17 |
Summary | This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402797 | AKIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405392 | AKIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402797 | Transient overexpression lysate of chromosome 11 open reading frame 17 (C11orf17), transcript variant 1 |
USD 396.00 |
|
LY405392 | Transient overexpression lysate of chromosome 11 open reading frame 17 (C11orf17), transcript variant 1 |
USD 396.00 |
|
PH323315 | C11orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065693) |
USD 2,055.00 |
|
TP760335 | Purified recombinant protein of Homo sapiens A kinase (PRKA) interacting protein 1 (AKIP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review