Cyclophilin F (PPIF) (NM_005729) Human Mass Spec Standard

CAT#: PH323397

PPIF MS Standard C13 and N15-labeled recombinant protein (NP_005720)

Product Images

Coomassie blue staining of purified PPIF protein (Cat# TP323397). The protein was produced from HEK293T cells transfected with PPIF cDNA clone (Cat# RC223397) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223397
• Predicted MW: 22.04 kDa
• Protein Sequence:
  Sequence Link

  >RC223397 representing NM_005729
  Red=Cloning site Green=Tags(s)
  
  MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV
  VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL
  SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005720
• RefSeq Size: 2213
• RefSeq ORF: 621
• Synonyms: Cyp-D; CyP-M; CYP3; CypD
• Locus ID: 10105
• UniProt ID: P30405, A0A024QZS4
• Cytogenetics: 10q22.3
• Summary: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq, Jul 2008]